DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG10560

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:417 Identity:84/417 - (20%)
Similarity:170/417 - (40%) Gaps:70/417 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LCYREC-------QKILENAQESAVRVKLLDYHLVRDLSAIGYL--GDYYA---LTLRYCHEEEE 54
            :|.||.       .::.|:..:..|:    ||...:.|.|...:  |:.||   |.|....|.::
  Fly    10 VCEREVPIPGWVKPEVFEDLLKDNVK----DYKKTKALRAKAGVAAGENYATIMLRLELDVETKD 70

  Fly    55 IIREIELFVKAMPQQSAE----LSKESIFQKESWLYDTLIKKLQAL-----SNVKWSPNC--VYS 108
            .....:.|:...|..:..    |.:.:||..|..:|..::.:|:.:     ..||:....  :..
  Fly    71 KSEVTKAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKV 135

  Fly   109 RKDLMVLENIKLKGFTSAGSAE-LNEVFVKPLIKSIAAFHSASLV-------YEHQTKTNIGHTY 165
            .::.::||:::.:||.:....: |::...:.:::..|.:|:||.|       ||.:      :|.
  Fly   136 SENYVLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEK------YTN 194

  Fly   166 GDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGN----REQSFIGDKLMGIMETIYEQAAPSK 226
            |     .....||..|....||.: ::.::.:|.|:    ::...:.:||..|...|.|   |..
  Fly   195 G-----FFKSKEIMNFFCDRSAKI-LLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKE---PKS 250

  Fly   227 KYRNVLCHRDIWAGNIFFPPENSGP---ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQ 288
            ...|.|.|.|.|:.||.|...:...   ...:|.|..::...|.||.:.|..:.|...:.:....
  Fly   251 DEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDY 315

  Fly   289 GIDLYHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYR-AVAATVVKVPTD------FIT 346
            .:..||:.|:::|..|...:.:.:...:..:..::..:..:.. :|...|:..|||      .|:
  Fly   316 FVWFYHSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKIIS 380

  Fly   347 NDFKYVDRSKVILSYMKTNPEFATYME 373
            |:......|      :.|||.:..:|:
  Fly   381 NEHSNFTNS------IYTNPRYRRHMK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 55/267 (21%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 63/295 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.