DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG10553

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:375 Identity:77/375 - (20%)
Similarity:152/375 - (40%) Gaps:35/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYHLVRDLSAIGYL--GDYYA---LTLRYCHEEEEIIREIELFVKAMPQQSAE----LSKESIFQ 80
            ||...:.:.|...:  |:.||   |.:....|:|:..:..:.|:...|.||.:    :.|..||.
  Fly    36 DYKATKSMRANAGVAAGENYATVMLRIELDVEKEDNTQTTKAFMLKTPHQSEQYRKVIEKTDIFD 100

  Fly    81 KESWLYDTLIKKLQAL-----SNVKWSPNC--VYSRKDLMVLENIKLKGFTSAGSAE-LNEVFVK 137
            .|..:|..::.:|:.|     ..||:....  :.:....::||:::.:||.:....| :::...:
  Fly   101 VERGMYVEVVPELEQLYRDVGLEVKFGAELYDIEASDYYVLLEDLRPRGFGNIDRLEGMDQAHTE 165

  Fly   138 PLIKSIAAFHSASLVY-----EHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAK 197
            .::|..|.:|:||.|.     .:|.|...|....:.:::..::..|..|...:.    :.:....
  Fly   166 CVLKKFAQWHAASAVRVETKGPYQEKYTKGFLRNEEIVDAFINRSIKVFLDNVH----LCKGYET 226

  Fly   198 YQGNREQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSG---PALLIDFQT 259
            |.  .:...:..|...|:|::..   ||......|.|.|.||.||.......|   ....:|.|.
  Fly   227 YL--NDLRIVSGKTFEIVESLNN---PSPDEFIALNHGDGWANNIMSQYNTKGEIQDTYFVDLQV 286

  Fly   260 CRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKSELLESYEEFR 324
            .::.....||.:.|..:.|...:.......|..||:.|:::|..||..:.:.:...:.::..::.
  Fly   287 PKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIWFYHSELVKHLKLLGYSKTLPTLRRINDALNKYS 351

  Fly   325 LFGVVYRA-VAATVVKVPTDFITNDFKYVDRSKVILSYMKTNPEFATYME 373
            .:..:..| :.|.|:..|.|....|....|......:.:..||.|..:||
  Fly   352 GWSFICTATILAYVLLDPVDGADFDKVLGDDDCSFKNSLYINPRFRKHME 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 53/261 (20%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 61/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.