DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG31087

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster


Alignment Length:413 Identity:98/413 - (23%)
Similarity:170/413 - (41%) Gaps:90/413 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ESAVRVKLLDYHLVRDLSAIGYLG-----DYYALTLRYCHEEEEI---IREIELFVKAM---PQQ 69
            |.||:.::.|:..:  :|.|...|     :|....||...|.|.|   .:::...:||.   ...
  Fly    27 EKAVQAQIGDFEKI--ISVIPQKGSSDGDNYSTQFLRLLVEVELIDHSTKDLSFVLKAQHSNEMM 89

  Fly    70 SAELSKESIFQKESWLYDTLIKKLQAL-----SNVKWSPNCVYSRKDL----MVLENIKLKGFTS 125
            :|.|:|..:||||..:|.:::.|.:.|     ..::::|......:||    ::||::..|.|.:
  Fly    90 AAILAKLKLFQKEEQMYHSILPKFEKLYADAGKPIQFAPKAFKFDRDLGVDYILLEDLHRKNFKN 154

  Fly   126 AGS-AELNEVFVKPLIKSIAAFHSASLVY-EHQTKTNIGHTYGDNLLEITVDSEIAWFTTGL--- 185
            |.. |.|:...:..:::.:||||:||..| ||.      ..:|:.            ||.|:   
  Fly   155 ANRLAGLDLDHMHKVLEKLAAFHAASACYVEHH------GLFGEE------------FTVGVFSE 201

  Fly   186 ---------SAVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYEQAAPSKKYR----NVLCHRDI 237
                     :|..|.:..|.|::..::   |.:||....:.:.::....::|.    |||.|.|.
  Fly   202 SNRQLLQEFNASGAFLAQLKKWKNAQK---IYEKLADSDDYLVDRLLQDQQYNTREFNVLNHGDC 263

  Fly   238 WAGNIFFPPENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQ 299
            ||.|:.:..:..|   ..|.:|||..:|..||:|    ||..:.||...:::....|....|...
  Fly   264 WANNVMYQHDAFGTIKETLFVDFQVGKYGSPAND----LYYLILSSAAPELKTAKFDYLVRYYFD 324

  Fly   300 NLSDLGLEELVISKSELLESYEE-----------FRLFGVVYRAVAAT--VVKVPTDFITNDFKY 351
            ||         |...:||:.:..           ||.....|..|:..  ||.:......|...|
  Fly   325 NL---------IENLKLLQYHRPLPKLKNLHASLFRNGLAAYMVVSKVLPVVMLDKTADANLESY 380

  Fly   352 VDRSKVILSYMKTNPEFATYMEE 374
            :.....:.:.|.|||::...|.|
  Fly   381 ISDESKMKNAMFTNPKYVQVMTE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 68/274 (25%)
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 77/316 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.