DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG10550

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:343 Identity:69/343 - (20%)
Similarity:139/343 - (40%) Gaps:65/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IFQKESWLYDTLIKKL-----QALSNVKWSPNCVY--SRKDL--MVLENI---------KLKGFT 124
            :|.||..:|:..|.:.     :|...::.:|.|::  :..:|  ||.|::         :|||| 
  Fly   100 LFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVFEDLSRQNFKNFDRLKGF- 163

  Fly   125 SAGSAELNEVFVKPLIKSIAAFHSASLV-------YEHQTKTNIGHTYGDNLLEITVDSEIAWFT 182
                   :...::.:::.:|..|:||:|       |:.....:|.:....:|.|          :
  Fly   164 -------DLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQSRDLFE----------S 211

  Fly   183 TGLSAVLAVVRSLAKYQGNREQSFIG---DKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFF 244
            .|.......::::..:.....:|:|.   |.|....|.:........:: |||.|.|.|:.||.|
  Fly   212 LGKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQVNQVDEDEF-NVLNHGDCWSNNIMF 275

  Fly   245 PPENSGP---ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGL 306
            ..:::|.   .:|:|.|..::..||.||.:.:..:.|...:.:.....|.:||..|.:.|..|..
  Fly   276 NYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLKLLNY 340

  Fly   307 EELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYVDRSKVILSYMKTNPE---- 367
            .:.:.:..:|.....::..:|.:..........:|||...|       .|:||:   ..||    
  Fly   341 SKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDAN-------MKMILA---QGPEADAI 395

  Fly   368 -FATYMEECCVDVMEMAL 384
             :.|::.......|::.|
  Fly   396 RYRTFINPYYAKAMKVLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 54/257 (21%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 55/258 (21%)
APH 108..338 CDD:279908 51/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.