DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG31370

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:386 Identity:81/386 - (20%)
Similarity:157/386 - (40%) Gaps:60/386 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QESAVRVKLLDYHLVRDLSAIGYLGDYYALTLRYCHEEEEIIREIELFVKAMPQQSA--ELSKES 77
            :|..:||..||:      :.....||.||..:  .....|.|.:...|.|::..::.  ..:..:
  Fly    30 KEPDLRVTKLDF------TPGSAKGDNYASVI--IRARVEYITQKGFFSKSLIIKTVLEMFAGSA 86

  Fly    78 IFQKESWLYDTLIKKLQAL-----SNVKWSPNCVY---SRKDLMVLENIKLKGFTSAGSAELNEV 134
            :|:.|..:|..::.:...:     ...:....|:|   ....:|:.|::....:.......|...
  Fly    87 LFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHG 151

  Fly   135 FVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSA---VLAVVRSLA 196
            .:......:|.||:.|:...:: :......:.|.:..:    :|.:.::|:..   .|..:..|.
  Fly   152 EICGAYSKLAKFHALSMKIINE-RPEFVKEFKDGICLV----DIPYMSSGMGPFKDFLGRIPELD 211

  Fly   197 KYQGNREQ---SFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFP--PENSG--PALL 254
            :|:.:.|:   .|| |:|..||:..  |..|...| .||||.|....||...  .|:.|  ..:|
  Fly   212 RYKTHFEKIEVHFI-DRLRDIMKEY--QTNPQPGY-YVLCHGDYHTRNIMVKHNKESGGFEDCML 272

  Fly   255 IDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLE-ELVISKSELLE 318
            :|:|.|..||.|.||.:.:||.::..:|....:..::.|.:.|.:.|..:|.: :|....:...|
  Fly   273 LDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKE 337

  Fly   319 SYE----EFRLFGVVYRAVAATVVKVPTDFITNDFKYVDRSKVILSYMKTNPEFATYMEEC 375
            .|.    || ||...|..::   |.:..:..||:              :|:.:...::|||
  Fly   338 MYRLKDYEF-LFLSTYLPMS---VGLSLETATNE--------------ETDDKLQDFIEEC 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 53/261 (20%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 60/287 (21%)
APH <202..320 CDD:279908 36/121 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.