DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG13659

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:297 Identity:65/297 - (21%)
Similarity:131/297 - (44%) Gaps:36/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GDYYA-----LTLRYCHEEEEIIREIELFVKAMPQQSA---ELSKES-IFQKESWLYDTLIKKLQ 94
            ||:||     ..:.|..:.....:  .|.:|.|..:..   ::.|:| :|..|..:|..::.:.:
  Fly    49 GDHYASIMFRARVEYTAQNGNFTK--SLIIKTMIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWE 111

  Fly    95 -----ALSNVKWSPNCVY---SRKDLMVLENIKLKGFTSAGSAELNEVFVKPLIKSIAAFHSASL 151
                 |....|....|:|   ....:::.:::...|:.......|....:......:|..|:.|:
  Fly   112 RILRRANDPAKLYVECIYHSLQPHQILIFDDLVEMGYAVVRDRFLTREEISSAYSKLAKIHAISM 176

  Fly   152 VYEHQTKTNIGHTYGDNLLEI--TVDSEIAWFTTGLS---AVLAVVRSLAKYQGNREQSFI--GD 209
            .:.|:....: ..:.:.|.|:  .:||.|  .:.|:.   .:|..:..|:|||.:.::..:  .|
  Fly   177 KFIHEQPEYL-KEFKNGLCEMPGLIDSSI--ISGGMDPFMEMLGRIPELSKYQPHFKKISLHFKD 238

  Fly   210 KLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFP-PENSG---PALLIDFQTCRYAPPASDLN 270
            :|   .||:.|.....:...|||||.|..:.|:.|. .:.:|   ..:|:|:|.|..||.|.||.
  Fly   239 RL---RETMQEYRNNPQPGYNVLCHADFHSRNMMFKNNKETGCFEDCMLLDYQGCNVAPMAVDLM 300

  Fly   271 FCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLE 307
            :.:||.:..::|::.....::.|.:.||:.|..:|.:
  Fly   301 YSIYMLMGPAQRREELDILLNYYLSILLETLKKIGYQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 58/264 (22%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 64/294 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.