DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG31104

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:379 Identity:93/379 - (24%)
Similarity:160/379 - (42%) Gaps:77/379 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLDYHLVRDL-------SAIGYLGDYYALTL-----RYCHEEEEIIREIELFVKAMPQQSAE--- 72
            |.:|..:.||       |.....||:||..:     .|...:.:..:  .|.:|.||:|...   
  Fly    28 LREYEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFFK--PLIIKTMPEQEGHKKD 90

  Fly    73 -LSKESIFQKESWLYDTLIKKLQAL-----SNVKWSPNCVY---SRKDLMVLENIKLKGFT---- 124
             ||:..:|:.|..:|...:.:.:.:     .|.|....|:|   ..:.:|:.|::..:|:|    
  Fly    91 MLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHSLKPRQVMIFEDLVPQGYTVIRD 155

  Fly   125 ---SAGSAELNEVFVKPLIKSIAAFHSASL-VYEHQTKTNIGHTYGDNLLEI-TVDSEIAWFTTG 184
               |.|..:|  .|.|     :|.:|:.|: |...|........||  |.|: |:|:: .:.|||
  Fly   156 SPPSLGDLKL--AFDK-----LAKWHAVSMKVINEQPYFLKEFQYG--LFEMPTIDTD-PFITTG 210

  Fly   185 LS---AVLAVVRSLAKYQGNREQSFIGDKLMGIMET-IYEQAAPSKKYRN-----VLCHRDIWAG 240
            ::   .:|..:..|.||:.:.|:  |.|..|..:|. ::|.    .|||.     ||||.|....
  Fly   211 MTNFIEMLDKMPELRKYKHHFEK--IKDNYMQRLEVEMHEY----HKYRRNDRYYVLCHGDFHLR 269

  Fly   241 NIFFPPENS----GPALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNL 301
            |:.|.....    ...:|:|||.....|...||.:.:||.:...:|.:|.:..|:.|.:.|:..|
  Fly   270 NMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGENLINEYFSVLVATL 334

  Fly   302 SDLGLEELVISKSELLE-----SYEEFRLFGVVYRAVAATVVKVPTDFITNDFK 350
            ..:|.:..:.::.||.|     .|.:|.|.        :|.:.:.....:||.|
  Fly   335 RKIGYKGDMPTQRELWEQIQNNKYYDFFLI--------STFLPIMVGVKSNDLK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 71/275 (26%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 77/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.