DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG10514

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster


Alignment Length:319 Identity:72/319 - (22%)
Similarity:130/319 - (40%) Gaps:45/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EEEEIIREIELFVKAMPQQSAELSKESIFQKESWLYDTLIKKLQALSN-----VKWSPNCVYSRK 110
            :::|:.:|:             ::...|:.:|..:|..::.|.:.|.|     .:..|..:|..:
  Fly    73 DDDELTQEL-------------MAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDR 124

  Fly   111 DLM--VLENIKLKGFTSAGSA-ELNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEI 172
            :.|  :.|::.:.|:..|... .|||.....:::.:|.||:|:.|. ::.::....:|.......
  Fly   125 ERMAIIFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVL-NERQSGCLESYDRGFFNR 188

  Fly   173 TVDSEIAWFTTGLSAV---LAVVRSLAKYQGNREQSFIGDKLMGI----METIYEQAAPSKKYRN 230
            ..::...:|..||.|.   ::.|.:||.|         |:||..:    |:...|..||:....|
  Fly   189 YTNAYSGYFVGGLLAAARWMSKVPTLAHY---------GEKLFALAPHYMDIGRECFAPTPGQVN 244

  Fly   231 VLCHRDIWAGNIFF--PPENSGP--ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGID 291
            ||.|.|:|..|:.|  .|....|  .||||||...:..|..||:.....:|....|:..:.....
  Fly   245 VLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQ 309

  Fly   292 LYHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKV---PTDFITN 347
            .||....:.|..|...:..|......:...|.:.|..::..|....|.:   |||...|
  Fly   310 FYHKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQDPTDACFN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 60/260 (23%)
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 63/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459511
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.