DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG10513

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:387 Identity:91/387 - (23%)
Similarity:142/387 - (36%) Gaps:117/387 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ENAQESAVRVKLL-----------DYHLVR-----DLSAIGYLGDYYALTLRYCHEEEEIIREIE 60
            :|......||::|           :|::|:     |..|.|....|...|           .|:.
  Fly    52 DNYASVMTRVRILFLKSGAKSPETEYYIVKTTYENDAFASGIFSQYQVST-----------TEMR 105

  Fly    61 LFVKAMPQQSAELSK----ESIFQKESWLYDTLIKKLQALSNVKWSPNCVYSRKDLMVLENI--- 118
            ::.|.:||.|:.:.|    |.:|.|      ||        :|.:....:.. :||.|.:.:   
  Fly   106 MYEKILPQLSSLIEKTRQPEKVFAK------TL--------HVDYEHEAIIF-EDLAVTKYVLAD 155

  Fly   119 KLKGF----TSAGSAELNEVFVKPLIKSIAAFHSASLVYEHQ-----TKTNIG----HTYGDNLL 170
            :|.||    |..|            ::.:|..|:|:.|...:     ||.:.|    ||      
  Fly   156 RLVGFDLEHTRLG------------LRKLAKMHAAAAVLNERQPGLLTKFDHGIFNRHT------ 202

  Fly   171 EITVDSEIAWF---TTGLSAVLAVVRSLAKYQGNREQSFIGD----KLMGIMETIYEQAA----P 224
                 ...|.|   |.|::|..|           ||...:|:    ||..:.|.:.|.:.    |
  Fly   203 -----QAFAPFFVNTVGVAADFA-----------RECPELGERYATKLKKLQERVMEYSTRVYDP 251

  Fly   225 SKKYRNVLCHRDIWAGNIFFP-PENSGP--ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQME 286
            .....|.|.|.|.|..|:... .||..|  ..|||||.|.::.||.||::....::....|.:.:
  Fly   252 QPGDFNTLVHGDYWVNNVMLRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQ 316

  Fly   287 KQGIDLYHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITND 348
            ......|||.|::.|.||.....:.:..:.:...|..|.|       |.||..|....:|||
  Fly   317 DALFQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFF-------AVTVALVCQAILTND 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 68/275 (25%)
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 81/343 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459515
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.