DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG6908

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:305 Identity:68/305 - (22%)
Similarity:124/305 - (40%) Gaps:70/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GDYYALTLRYCHEEEEI----IREIELFVKAMPQQS--AELSKESIFQKESWLYDTLIKKLQAL- 96
            |:.|...|...:.|.|:    .:.|....|.:|...  ..::...:|.||...|...|.:.:.: 
  Fly    82 GENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMY 146

  Fly    97 ----SNVKWSPNCVYSR----KDLMVLENIKLKGFTSAGSAE-LNEVFVKPLIKSIAAFHSASLV 152
                ..:.:.|....|:    .:|:|||::..:||.:..... |:....:..::.:|.||:||.|
  Fly   147 KDAGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAV 211

  Fly   153 YEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFI---------- 207
             ..:.|.:....|..||                   .:||.||.:.:.|:.:::|          
  Fly   212 -RFELKGSYPEEYNQNL-------------------CSVVDSLKELRENQLKAYIDAFPLYDASH 256

  Fly   208 --------GDKLMGIMETIYEQAAP--SKKYRNVLCHRDIWAGNIFFPPENSGPAL---LIDFQT 259
                    |.:    .:.:::..||  ..::| ||.|.|.|..||.:..:.:|...   .:|.|.
  Fly   257 LTNDVQAYGSQ----ADDMFQSFAPKIEGEFR-VLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQM 316

  Fly   260 CRYAPPASDLNFCLYMNLSSSKRK-QMEKQG--IDLYHTYLLQNL 301
            .|::.||.||   ||:.|||::.. ::.|..  |..||..|:::|
  Fly   317 SRFSSPAQDL---LYLILSSTELDIKIAKFDYLIKFYHEKLIESL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 62/277 (22%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 68/305 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.