DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG6834

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:407 Identity:97/407 - (23%)
Similarity:161/407 - (39%) Gaps:76/407 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ECQKILENAQESAVR------VKLLDYHLVRDLSAIGYLGDYYALTLRYCHEEEEIIREIELFVK 64
            |..||:..:..||.:      .|||...:...|.      |:.:.|..|             .:|
  Fly   514 EFDKIVGGSWSSATKPGDNFASKLLKIDIETQLK------DHTSKTFSY-------------ILK 559

  Fly    65 AMPQQSAE-LSKESIFQKESWLYDTLIKKLQAL-----SNVKWSPNCVYSRK----DLMVLENIK 119
            ..|:.:.: .:..::|.||..:|...:...:.|     ..|.::.|.....|    :.:::||::
  Fly   560 VQPKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKEEYLLMENLQ 624

  Fly   120 LKGFTSAGSAE-LNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGH--TYGDNL-LEITVDSEIAW 180
            .|||..|...: ||....|..:|.:|.:|:||:.|:   :.|..:  .|.|.: :|.|.|   .:
  Fly   625 TKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYK---ELNGAYPPLYNDGIYIEQTRD---VF 683

  Fly   181 FTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMET----IYEQAAPSKKYRNVLCHRDIWAGN 241
            .....||..|.:|....::|..|..   .||..|::.    :.|.|..:::..|||.|.|.|..|
  Fly   684 HNMFASAKEAYIRIFGTFEGADEYL---PKLEWIIDNHVDQVLEDAKINEQAFNVLNHGDAWINN 745

  Fly   242 IFFPPENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGID----LYHTYLLQ 299
            |.|..:..|   ...|:|.|..:|..||.|    ||..|.||....::....|    .||..|::
  Fly   746 IMFQYDAEGRLKETYLLDHQNAKYGNPAQD----LYYFLISSAELDIKVDEFDNLIRFYHENLVE 806

  Fly   300 NLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITND-------FKYVDRSKV 357
            :...|.....|.|.|||.....|...|.|      .||:...|..:|::       |.....|:.
  Fly   807 HTKLLKYNGFVPSLSELHAILIEHPAFAV------GTVISTLTVCLTDEGFNPELFFVETPESEA 865

  Fly   358 ILSYMKTNPEFATYMEE 374
            ..:.:..|..:..::|:
  Fly   866 FRTKLLGNERYKAHVEK 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 68/266 (26%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 76/315 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.