DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG13813

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:380 Identity:86/380 - (22%)
Similarity:139/380 - (36%) Gaps:89/380 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DYYALTLRYCHEEEEIIREIELFVKAMPQQSAELSKESIFQKESWLYDTLIKKLQALSNVKWSPN 104
            ||||             ||:.::.|..|...|.....:.|        |:...|||        |
  Fly    74 DYYA-------------REVFMYQKVFPVFRALSPDRNTF--------TVAPALQA--------N 109

  Fly   105 CVYSRKDLMVLENIKLKGFTSAGSAELNEVFVKPL-------IKSIAAFHSASLVYEH----QTK 158
            .:.:..:.::.|::...||..      |...:.|.       :|::|..|:.|.:.:.    |.|
  Fly   110 DLKAPDEFLIFEDLSESGFRP------NSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFK 168

  Fly   159 TNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIME------- 216
            ..:.....|||  .|.|.|......| .|.|...|.:.|...       ||::..:.|       
  Fly   169 QLVEFVEKDNL--FTSDIEEVTIEFG-KAQLRKARIILKESD-------GDQVAAVQEVLQLCEN 223

  Fly   217 -----TIYEQAAPSKKYRNVLCHRDIWAGNIFF--PPENSGP--ALLIDFQTCRYAPPASDLNFC 272
                 .:|.....::....|:||.|.|..||.:  .|.:..|  |.|||||..|||||..|:...
  Fly   224 QLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHY 288

  Fly   273 LYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLE-ELVISKSELLESYEEFRLFGVVYRAVAAT 336
            |:.......|.:.....:|.|:..:.|.|....|. |.:..:|......:::.::|::..|.:..
  Fly   289 LFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLP 353

  Fly   337 VVKVPTDFITNDFKYVDRSKV-----ILSYMKTNPEFATYMEECCVDVMEMALAR 386
            .      ||:|..:.:|...|     .:|.....|::...:||     .||..||
  Fly   354 F------FISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEE-----YEMLNAR 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 62/268 (23%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 68/291 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.