DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG11891

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster


Alignment Length:329 Identity:73/329 - (22%)
Similarity:131/329 - (39%) Gaps:104/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 REIELFVKAMPQQSAELSKESIFQKESW---LY-----DTLIKKLQALSNVKWSPNCVYSRKDL- 112
            ||::|:.:.:||.:..:..|....::.:   :|     |::|.:..:|.|.:.:..  ..:.|| 
  Fly    96 RELDLYERILPQMAEVVRNELADSRKLFAGTVYVDRKRDSIIFEDMSLENYRVADR--LKKLDLE 158

  Fly   113 ---MVLENIKLKGFTSAGSAELNE----VFVK---------------PLIKSIAAFHSASLVYE- 154
               :|||  ||..|.:||:| |.|    :|.|               |::|::....|.||..| 
  Fly   159 HTHLVLE--KLANFHAAGAA-LAERQPGIFAKNFDRGFFNQHTRGYEPIMKNLLMALSRSLELEP 220

  Fly   155 -----HQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFI-GDKLMG 213
                 :|.|.       |.|:|                      ::.:| |.|..:.: ||.|  
  Fly   221 DLCQRYQAKI-------DRLVE----------------------NVMEY-GERSTTIVPGDFL-- 253

  Fly   214 IMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSG---PALLIDFQTCRYAPPASDLNFCLYM 275
                             .|.|.|:|..||.|..::.|   .|:.||||...:..||.||::....
  Fly   254 -----------------TLAHGDLWTTNIMFQYDDKGHPINAIFIDFQFSAWNSPAIDLHYFFST 301

  Fly   276 NLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKS--ELLESYEEFRLFGVVYRAVAATVV 338
            .|.:..|.:.:.:.:..|:..|     :..|:::..|.:  .|...:::||  ...:.|..|:::
  Fly   302 ALQADIRLKKQPELVQFYYYKL-----NAALKKVQYSGNVPSLFVFHQQFR--NRSFYAAFASLI 359

  Fly   339 KVPT 342
            ..||
  Fly   360 FEPT 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 61/282 (22%)
CG11891NP_001027211.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
44.010

Return to query results.
Submit another query.