DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG33511

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:419 Identity:123/419 - (29%)
Similarity:209/419 - (49%) Gaps:55/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLCYRECQKILENAQESAVRVKLLDYHLV--------RDLSAIGYLGDYYALTLRYCHEEEEIIR 57
            :|...||..|   ||.:...||..:..|:        :||  :||:|:||.|     |.|.|:..
  Fly     3 LLSSEECHLI---AQRTLSVVKKDNVILINSQVDAGSKDL--MGYMGEYYKL-----HLEAEVKG 57

  Fly    58 E-----IELFVKAMPQ----QSAELSKESIFQKESWLYDTLIKKLQALSNVKWSPNCVYSRKDLM 113
            :     :..|:|::|:    |..|..::.:|||||.||..::.|:|..:..|..|.|.|||.|::
  Fly    58 DKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKKLYPKCYYSRNDIL 122

  Fly   114 VLENIKLKGFTSAGSAELNEVFV----KPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITV 174
            |||::.    ........||.:.    |.:::.::..|:||:.:|.:....|..:|.:.|:|:.:
  Fly   123 VLEDLT----QDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHL 183

  Fly   175 DSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWA 239
            ||..:|:.|||.|::.:......:|..:.|:||.|||..::....|..||||..||||||||.|.
  Fly   184 DSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWD 248

  Fly   240 GNI--FFPPENS---GPALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQ 299
            .||  :|..|:|   ....::|||..:|..|..|:.|.||:..|:..|:.:..:.::.|:..|..
  Fly   249 HNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQH 313

  Fly   300 NLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITN--------DFKY---VD 353
            :|..|||::.:|:::...:..:..||..:|..|:.....|: :..|:|        .|.|   .|
  Fly   314 HLDRLGLDKNLITENNFRKECQRTRLAALVIWALTEPQTKM-SPSISNRLRSEEPEKFDYYLNCD 377

  Fly   354 RSKVILSYMKTNPEFATYMEECCVDVMEM 382
            ||:::|..::..|   .|.|.....:.|:
  Fly   378 RSELLLRVIEIQP---GYEETIMTPIREL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 81/254 (32%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 91/286 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333735at33208
OrthoFinder 1 1.000 - - FOG0005926
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.