DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG31974

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:336 Identity:54/336 - (16%)
Similarity:107/336 - (31%) Gaps:112/336 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YHLVRDLSAIGYLGDYYALTLRYCHEEEEIIREIELFVKAMPQQSAELSKESIFQKESWLYDTLI 90
            |:|...:..:.||..|:||.:                       :..|.|..::::....|   .
  Fly   158 YNLAETVLILHYLAQYHALPI-----------------------ALRLKKPQVYEEYVRPY---F 196

  Fly    91 KKLQALSNVKWSPNCVYSRKDLMVLENIKLKGFTSAGSAELNEVFVKPLIKSIAAFHSASLVYEH 155
            ||....||:..:...:.:::   :|::|||   .::...::|.  ||.|:....||.:::     
  Fly   197 KKFDMNSNIDQAETEIMNKE---ILKDIKL---VTSDERDVNR--VKELLDIFQAFQASN----- 248

  Fly   156 QTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYE 220
                               |.:...|||                                     
  Fly   249 -------------------DVDDGPFTT------------------------------------- 257

  Fly   221 QAAPSKKYRNVLCHRDIWAGNIFFP----PENSGP--ALLIDFQTCRYAPPASDLNFCLYMNLSS 279
                       |.|.|:|..|:...    .|...|  ..::|||..:|.....|:.|.|:.::..
  Fly   258 -----------LVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDV 311

  Fly   280 SKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDF 344
            :..:......:.:|:...:|.|..:.::....:....||..::.....:.:......|:......
  Fly   312 NVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNST 376

  Fly   345 ITNDFKYVDRS 355
            |..|:|.||.|
  Fly   377 IPKDYKDVDFS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 38/247 (15%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 45/284 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459640
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.