DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG7135

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:338 Identity:84/338 - (24%)
Similarity:140/338 - (41%) Gaps:48/338 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DLSAIG------------YLGDYYALTLRYCHEEEEIIREIELFVKAMP-QQSAELSKESIFQKE 82
            ||..||            |..:.|...::| ...|....|..|.||:|| ::.|.|::..|:.||
  Fly    29 DLQVIGVQLTNLTRGGENYCSNIYRAQIKY-RNAESCAMETSLIVKSMPDEKQAILARLHIYNKE 92

  Fly    83 SWLYDTLIKKLQAL------SNVKW--SPNCVYSR---KDLMVLENIKLKGF-TSAGSAELNEVF 135
            :..|..:..||:||      |...|  :|...||.   :..::||::...|: .......|:...
  Fly    93 TLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDH 157

  Fly   136 VKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEI-TVDSE--IAWFTTGLSAVLAVVRSLAK 197
            ...::..:|.:|:.::|...:....|...|...||.: .::||  ...|.|.|..:.|:|.....
  Fly   158 AALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEG 222

  Fly   198 YQGNREQSFIGDKLM----GIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPE---NSGPALLI 255
            :.|      |..||.    ...|.:.:...|.:...|||.|.|:|..||||..:   ......:|
  Fly   223 FGG------ITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKII 281

  Fly   256 DFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKSELL--- 317
            |||.|.|.....|:|:.|..:|.....:...::.:|:|:..|:..|..|...:.:.|..:::   
  Fly   282 DFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEI 346

  Fly   318 ---ESYEEFRLFG 327
               |:|..|..||
  Fly   347 RKREAYGFFVAFG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 67/264 (25%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 73/293 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459281
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.