DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG31099

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:415 Identity:90/415 - (21%)
Similarity:173/415 - (41%) Gaps:98/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLCYRECQKILENAQESAVRVKLLDYHLVRDLSAIGYLGDYYALTLRYCHEEEEIIREIELFVKA 65
            ::.:|.|..:|    ...|:|:|.|:                            .::::...:||
  Fly    38 LIQFRNCTVLL----PIQVKVQLRDF----------------------------TMKKLFFLLKA 70

  Fly    66 M---PQQSAELSKESIFQKESWLYDTLIKKLQAL-----SNVKWSPNCV---YS-RKDLMVLENI 118
            .   ..|:..:::..:||:|..:|..::.||:.:     ..|.:.|...   || ....::||::
  Fly    71 QHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLLEDL 135

  Fly   119 KLKGFTSA-GSAELNEVFVKPLIKSIAAFHSAS--LVYEHQTKTN--IGHTY---GDNLLEITVD 175
            |.|.:.:. ..|..|::.:|.::|.:|.||:||  .|.:|...:|  :...|   .:::|:...|
  Fly   136 KAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANESVLQELND 200

  Fly   176 SEIAWFTTGLSAVLAVVRSLAKYQ-GNREQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWA 239
            .||            .:..|.::: |:.....:.:|...:::.:.:..:|.....|||.|.|.|.
  Fly   201 PEI------------FLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWV 253

  Fly   240 GNIFFPPENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGID----LYHTYL 297
            .|:.|..::||   ...|:|:|..:|..||.|    ||..:.||..|.::....|    .|..:|
  Fly   254 NNVMFKFDDSGHVEDTALLDYQLVKYGSPAID----LYYTILSSAEKDIKLAQFDNMVQYYFYHL 314

  Fly   298 LQNLSDL----GLEEL-----VISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYVD 353
            |.||..|    .|.:|     .::|:.|       ..:.||.||:..|::....|.:..  :|..
  Fly   315 LDNLKALNFGGSLPQLQHIRDALNKNGL-------AAYVVVTRALPITMMNQFEDEVNE--RYAS 370

  Fly   354 RSKVIL----SYMKTNPEFATYMEE 374
            :.|..:    .|::...:...:|||
  Fly   371 KMKCAMFTSRKYIQAIKDILPWMEE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 67/273 (25%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 73/326 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459706
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.