DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG1561

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:296 Identity:71/296 - (23%)
Similarity:115/296 - (38%) Gaps:69/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LFVKAMPQQSAELSKESIFQKESWLYDT----LIKKLQALSNVKWS----------PNCVYSRKD 111
            |.||..||.  .:.::..|.:..:|.:|    :...|.||...||.          ..|..:|:|
  Fly   278 LVVKLPPQN--RVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGDDRFRQHALCFGTRQD 340

  Fly   112 ----LMVLENIKLKGFTSAGS-AELNEVFVKPLIKSIAAFHSASL------------------VY 153
                .:|||::...||:.... .:|:...|:.::.:.|..|:.||                  ::
  Fly   341 EPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQLVDIF 405

  Fly   154 EHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMETI 218
            |.:...:....|.:||.|           :.|||:||....  .|:...|..|       ...:.
  Fly   406 EQRRDDHALGVYFENLKE-----------SALSALLAPADD--AYRVRLEAYF-------ARGSY 450

  Fly   219 YEQAAPSKKYRN-----VLCHRDIWAGNIFFPPENSG---PALLIDFQTCRYAPPASDLNFCLYM 275
            :|...|.....|     |:||.|.|..||.:.....|   ...|||:|..|||.|.:||.:.|:.
  Fly   451 FELLLPLVSGFNCEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFT 515

  Fly   276 NLSSSKRKQMEKQGIDLYHTYLLQNLSDLG--LEEL 309
            ..|...|::..:..::.|:..|...|..||  :|:|
  Fly   516 CTSRRFRQRHLENMLEDYYEELGLQLIRLGERVEQL 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 66/286 (23%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 68/289 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.