DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG31975

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:400 Identity:81/400 - (20%)
Similarity:147/400 - (36%) Gaps:109/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KLLDYHLVRDLSAIGYLGDYYALTLRYCHE----------EEEIIREI--------ELFVKAMPQ 68
            :||:||    .|::...||.|...|...|.          ||:::.::        :.|   .|:
  Fly    24 RLLNYH----TSSLTKPGDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQFF---QPE 81

  Fly    69 QSAELSKESIFQKESWLYDTLIKKLQAL---------SNVKWSPNCVYSRKDL------------ 112
            |:.        ..|:.:|..|...|..|         |..|..|.....|:.|            
  Fly    82 QTC--------LTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAV 138

  Fly   113 MVLENIKLKGFTSAGSAELNEVFVKPL-IKSIAAFHSASL--------VYEHQT----KTNIGHT 164
            :||||::..|:.|....:..::....| :|.:|.||:.||        |:..|.    |....|.
  Fly   139 LVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVRPFFKKFDWHA 203

  Fly   165 YGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYE--QAAPSK- 226
            ....           |.:...:..|..:|     :.....|.:..::..:.:..:|  .|||.: 
  Fly   204 EAPE-----------WKSVMKAETLEDIR-----RATNNDSRLVARMKELSDQFFEFLAAAPDRP 252

  Fly   227 --KYRNVLCHRDIWAGNIFFPPENSGPAL---LIDFQTCRYAPPASDLNFCLYMNLSSSKRKQME 286
              .:.::: |.|.|..||.|....:|..:   :|||||.:|.....|:...|..::.::..:...
  Fly   253 DGPFTSII-HCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEF 316

  Fly   287 KQGIDLYHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVP-----TDFIT 346
            :..::.|:....:.|..:|      :|.| :.:::||||     .......::||     |.||.
  Fly   317 EHMLEAYYEAFERCLRRVG------AKLE-VHTFKEFRL-----EVKRVAYIQVPHAIFMTRFIL 369

  Fly   347 NDFKYVDRSK 356
            .|...:..|:
  Fly   370 ADSALIGDSE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 54/283 (19%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 62/326 (19%)
APH <214..329 CDD:279908 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459636
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.