DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG31288

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:420 Identity:86/420 - (20%)
Similarity:183/420 - (43%) Gaps:84/420 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QKILEN--AQESAVRVKLLDYHLVRDLSAIGYLGDYYALTLRYCH-----EEEEIIREIELFVKA 65
            :|..|:  |::....||:|.:.:|..:..    |:.:..|:...:     ::..:..:..:|...
  Fly    22 EKYFESVLAKDEPDHVKVLKFTVVAAIPP----GENFTSTMLRVYIKLEMKDGSVKTKTYIFKTM 82

  Fly    66 MPQQ--SAELSKESIFQKESWLYDTLIKKLQAL-SNVKW----SPNCVYSRK---DL-MVLENIK 119
            :|::  .:::::..:|.||:.:|.|.:...:|| .:|.|    :|.|:::.:   |: .:.|::.
  Fly    83 LPEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEEREGDIHFIFEDLC 147

  Fly   120 LKGFTSAGSAE-LNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSEIAWFTT 183
            :|.|.:....: |:...:...::.:|.:|:||.|||.              |.....||   |:.
  Fly   148 VKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEE--------------LHGPYPSE---FSE 195

  Fly   184 GLSAVLAVVRSLAKYQGN----REQSFIGDKLM---GIMET-IYEQAAPS-KKY----------- 228
            |.     |.:.:.|:..:    :|:::  .|.|   |:.:. .|.:|.|: |:|           
  Fly   196 GF-----VKKDVKKFHVDGFQLKEKAY--KKAMLSWGLKDADKYIKAFPTVKQYWAQCLSTLELN 253

  Fly   229 ---RNVLCHRDIWAGNI---FFPPENSGPALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEK 287
               .:||.|.|.|:.|:   :.|.......:|||||...:..||.||.|.|.::.::..|.:...
  Fly   254 PDEFHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFD 318

  Fly   288 QGIDLYHTYLLQNLSDLGLEELVISKSELLES-----YEEFRLFGVVYRAVAATVVKVPTDFITN 347
            ..:.:|...|::.|..|.|::.:....:|..|     :..:..|.::..   ..::..|||..:|
  Fly   319 HFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNH---LPIILFPTDKDSN 380

  Fly   348 DFKYVDRSKVILSY---MKTNPEFATYMEE 374
            .......::...:|   :.:||.|...|::
  Fly   381 IHNLSANTEEGENYRLRLLSNPAFGNVMKD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 62/279 (22%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 64/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.