DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG2004

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:393 Identity:83/393 - (21%)
Similarity:151/393 - (38%) Gaps:64/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YLGDYYALTLRYCHE----EEEIIREIELFVKAMPQ--QSAELSKESI-FQKESWLYDTLIKKLQ 94
            ||...:.:|:....|    ::|...||.:.|||||.  ....|.:..| |:.|...|..::..::
  Fly    46 YLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIE 110

  Fly    95 ALSNVKWS---------PNCVYSR----KDLMVLENIKLKGFTSAGSAELNEVFVK-----PLIK 141
            |....:..         |.|:.|.    .|.:.||::..:|:    .|.:.:.::.     ..::
  Fly   111 AFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGY----RAPVRQDYISLEDALLTMR 171

  Fly   142 SIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSEIA--WFTTGL----SAVLAVVRSL---AK 197
            ::..||..:|.:......|.....|.  ||.|...|..  |:|..|    :.....|:.:   :|
  Fly   172 TLGRFHGVALAFNALDSKNFEKAAGS--LEETYYGEHTREWYTGFLLLAENVATDAVKQIYPNSK 234

  Fly   198 YQ---GNREQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSGPA---LLID 256
            |:   .|..|..:.|.|:.::.|        :...:|..|.|.|..|........|.:   ::||
  Fly   235 YETVATNFLQPPLFDDLINLVST--------RSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIID 291

  Fly   257 FQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDL-----GLEELVISKSEL 316
            ||..|.:..|.||:|.:|...|...|:|...:.:..|    |::..||     |..|.:||...|
  Fly   292 FQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAY----LESAQDLIQDLGGNAESIISWESL 352

  Fly   317 LESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYVDRSKVILSYMKTNPEFATYMEECCVDVME 381
            .|..:.|..||......:..:..:..|.:. |...:..:.::.......|...:..::...|:.:
  Fly   353 QEELKNFGRFGCGMGIESLPMTMMEDDEVA-DLDGIKENAILTDIWNITPFKESAKQQRLADIFK 416

  Fly   382 MAL 384
            .|:
  Fly   417 HAI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 62/282 (22%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 69/311 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.