DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and CG33301

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:292 Identity:65/292 - (22%)
Similarity:122/292 - (41%) Gaps:64/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SAELSKESIF------QKESWLYDTLIKKLQAL-----SNVKWSPNCVYSRKD--LMVLENIKLK 121
            |||:.:..:|      .:|..:|:.::.||:.|     .:.|.:.:.:...::  .|:||::...
  Fly    71 SAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNTMILEDLAPY 135

  Fly   122 GFTSAGSA-ELNEVFVKPLIKSIAAFHSASLVYEHQ-----TKTNIGHTYGDNLLEITVDSEIAW 180
            .|.:|... :|:....:..::.:|.||:||:|.:.:     ||....|                :
  Fly   136 KFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTH----------------F 184

  Fly   181 FTTGLSAVLAVVRSLAKY-------QGNREQSFIGDKLMGIMETIYEQAAPS----KKYRNVLCH 234
            |:....|...|...|.|.       |.|.:::: ||||..:...|.|..|.:    :.....|.|
  Fly   185 FSRDKKAYSVVFAGLFKAFLRFIDGQPNLKEAY-GDKLHKLRTHIMEYGARAYDVGESDLKTLNH 248

  Fly   235 RDIWAGNIFFPPENSG---PALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQM---EKQGIDLY 293
            .|.|..||.|..:::|   ..:.||||......|..||::.    .::|.|:::   |.:.::.:
  Fly   249 GDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYF----FTTSLREEVGDKESELVEHH 309

  Fly   294 HTYLLQNLSDLGLEELVISKSELLESYEEFRL 325
            :..|..||..       .|....|.:.:|:||
  Fly   310 YKALKANLEK-------FSYKGSLPTLQEYRL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 60/270 (22%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 60/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459495
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.