DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and nhr-246

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:277 Identity:64/277 - (23%)
Similarity:108/277 - (38%) Gaps:49/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LMVLENIKL----KGFTSAGSAELNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEI 172
            |.:||:.||    .||        ||..:..::..:...|..||..|             ...||
 Worm   137 LEMLEDCKLHDLIPGF--------NEDQLFKIVDELVKLHIFSLTTE-------------KWKEI 180

  Fly   173 TVDSEIAWFTTGLSAVLA-VVRSLAKYQGNREQSFIGDKLMGIMETIYEQAAPSKKYR------- 229
            ..|......:..|..::| |.|.||:   |.|   :|..|..:..|:.......:|.|       
 Worm   181 VPDESKLAMSGFLQCMVADVGRKLAQ---NPE---LGVILSYVENTLDTDPNYLQKMRDEYINEE 239

  Fly   230 --NVLCHRDIWAGNIFFPPENSGPALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDL 292
              :|:||.|:||..|.:..|:: .|.::|:|......|..||:..|....|...||...|..:|.
 Worm   240 RPSVICHGDLWAPQILWDKEDN-IAGIVDWQATHRGSPMEDLHHILSTCTSVQNRKTFTKPLLDH 303

  Fly   293 YHTYLLQNLSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYVDRSKV 357
            |:..|...|.:.|. :...::.|:...|....::| ..|.:.|......:..:..|.| .|..::
 Worm   304 YYNKLKVGLKEKGF-KTTWTREEIDIEYNYSFIYG-ASRTIFANGFWANSPVLQTDGK-PDPERI 365

  Fly   358 ILSYMKTNPEFATYMEE 374
            ..|:::..    :|:|:
 Worm   366 KESFVRCK----SYLED 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 52/206 (25%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 52/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.