DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and H37A05.2

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:278 Identity:61/278 - (21%)
Similarity:116/278 - (41%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 REIELFVKAMPQQSA-----ELSKESIFQKESWLYDTLIKKLQALSNVKWSPNCVYSRKDLMVLE 116
            ||::::...|.::.|     .||.|:.         |.:..|:|....::.||          |.
 Worm   116 REVDMYRIIMREKPACPTVNVLSLEAF---------TELSPLKAYIISEYIPN----------LH 161

  Fly   117 NIKLKGFTSAGSAELNEVFVKPLIKSIAAFHS--ASLVYEHQTKTNIGHTYGDNLLEITVDSEIA 179
            ::.:....|     :.|::.  ::..||||.:  .|:..:.:.|:.||..|.:..::...|.:  
 Worm   162 HVGMNDCIS-----IEEIWA--VVDGIAAFSAMGESMSEDEKKKSTIGEIYIEEAVKYFFDDQ-- 217

  Fly   180 WFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIME--TIYEQAAPSKKYRNVLCHRDIWAGNI 242
             ....:...|.::..:|..:...|...|.|...|..|  ..|.:.:....:..||.|.|||..|:
 Worm   218 -SPDNMRKNLIMILGVAYEEKVEEAMDIFDLYCGSSEIQKNYSRVSAFLGHSPVLMHSDIWPSNL 281

  Fly   243 FFPPENSGP---ALLIDFQTCRYAPPASDLNFCLYMN-LSSSKRKQMEKQGIDLYHTYLLQNLSD 303
            .|...:...   ..||||||...:.|..|:. ||.:. ||...|:.::.:.:|.|:...:::|..
 Worm   282 LFSLSSENKLEFKALIDFQTASLSSPGLDVG-CLTVTCLSKKDRRTVQSEILDRYYKSFVKSLKT 345

  Fly   304 LGLEELVISKSELLESYE 321
              ...:..::.:|.:|||
 Worm   346 --PNSIPYTREQLEDSYE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 55/254 (22%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 61/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.