DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and F20D6.5

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_505104.3 Gene:F20D6.5 / 184724 WormBaseID:WBGene00017635 Length:376 Species:Caenorhabditis elegans


Alignment Length:286 Identity:58/286 - (20%)
Similarity:102/286 - (35%) Gaps:95/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQG 200
            ::| :|::|.|||.....:.:..:|:..           |...:||||             .:..
 Worm   137 IEP-VKNLARFHSIGAELDEEEGSNVPR-----------DFLSSWFTT-------------LFTQ 176

  Fly   201 NREQSFIGDKLMGIMETIYEQAAPSKKYRN----------------------------VLCHRDI 237
            ..:.:|||:....:.:.:     |||..|:                            ||||.|.
 Worm   177 QNKNTFIGNWKGDLSDWL-----PSKVARDTIKELDGLLTPEIFLKLNNDCQLTGVQEVLCHGDY 236

  Fly   238 WAGNIFFPPENSGP---ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQ 299
            ...|:.:.....|.   ..::|||:..:...|.||:......:|...|:..|.:.:.:|:..|::
 Worm   237 SFHNLLYEKHCDGSYKFRAIVDFQSVNWGNAAQDLSRLFVTAMSGKDRRDSEDRLLKIYYDELIK 301

  Fly   300 NLSDLGLEELVISK--------SELLESYEEFRLFGVVYRAVAATVVKVPTDF-ITNDFKYVDRS 355
                       :||        .:|.:||..   |..::.|:..||  .|..| :|...|:..:.
 Worm   302 -----------VSKGNVAPFTWEQLKQSYTR---FFQLHAAIVCTV--TPGLFLVTLSGKHEGKE 350

  Fly   356 KVILSYMKTNPEFATYMEECCVDVME 381
            ||         ||...|.|..|.::|
 Worm   351 KV---------EFRNIMIEKYVGLLE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 37/199 (19%)
F20D6.5NP_505104.3 PKc_like 11..369 CDD:389743 58/286 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3982
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.