DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33509 and C29F7.1

DIOPT Version :9

Sequence 1:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:288 Identity:62/288 - (21%)
Similarity:114/288 - (39%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IELFVKAMPQQSAELSKESIFQKESWLYDTLIKKLQALSNVKWSPNCVYSRKD------LMVLEN 117
            :|||:     .:.|.:..::|:|    |..|..|:..:       .|.....|      ::|:|.
 Worm    99 MELFM-----HNTECNYYNVFRK----YTDLPMKVPVI-------YCAAKAGDAEAPVPVIVMEM 147

  Fly   118 IK-------LKGFTSAGSAELNEVFVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVD 175
            .:       :.||      :.:::|  .::..|...|..||..|....     ...|:.:..|||
 Worm   148 FEDCTVHDLIDGF------DKDQLF--KIVDEIVNLHIFSLTTEEWRS-----VLPDSAMRDTVD 199

  Fly   176 SEIAWFTTGLSAVLAVVRSLAKYQGNR------EQSFIGDKLMGIMETIYEQAAPSKKYRNVLCH 234
            ...|...|       :..::||..|..      |::|  ||....|....::....|: ::||.|
 Worm   200 LFEAMVKT-------IAENMAKSPGLEIISKYIEKTF--DKDPSFMTKFSDEYLEGKR-KSVLTH 254

  Fly   235 RDIWAGNIFFPPENSGPALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQ 299
            .|:|:..|.:..::: .|.:||:|......|..||:..|....|...|.::.|..:|.|...|..
 Worm   255 GDLWSPQILWDKDDN-IAGIIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLDHYFEKLSA 318

  Fly   300 NLSDLGLEELVISKSELLESYEEFRLFG 327
            .|.:.|: ::..::.|:.|.|.....:|
 Worm   319 GLEEKGV-KMPWTREEVDEEYNHCFSYG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 54/260 (21%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 46/203 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.