DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and pkdc

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:351 Identity:70/351 - (19%)
Similarity:112/351 - (31%) Gaps:137/351 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VKKDNVILINSQVDAGSKDLM----------GYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRK 74
            :||::..|:..  :.|:|.|.          || ||..::|||.   .|:....:.:.:      
Zfish     1 MKKEHQDLVLK--ECGAKSLQIGAKIQTLWSGY-GEIIRVHLEG---CDRPSVVVKHVM------ 53

  Fly    75 NEPQREE----------CERK-GVFQKESALYSQILPKIQKYATKK--LYPKCY----YSRNDIL 122
             .||.::          .:|| ..:|.|:..|       |.|.|.:  ..|.|.    :....::
Zfish    54 -FPQNQKHPGGWNTDISHQRKVRSYQVETYWY-------QNYTTNENCRVPLCLAAKSFGEEQLI 110

  Fly   123 VLEDLTQDYRHLRANEYYTLD-HYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSN 186
            |||||  |.......:.|..| ..|..|..::..||                     :.|.:...
Zfish   111 VLEDL--DVAGFPVRKTYVNDAEIKACLSWIANFHA---------------------LFLDVTPE 152

  Fly   187 NSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSK--------TIRNVL-- 241
            ..|.|                          ...::|.|:.|||.|.|.        .|.::|  
Zfish   153 GLWPI--------------------------GTYWHLETRPEELEAMSDQKLKAAAGEIDSILNN 191

  Fly   242 CHRDTWDHNIVYYFNKESSVLPNAC--------CIVDFQLTQYCSPTLDVLFLLYIVASAEVRRA 298
            |...|..|.        .:.|.|.|        ..|||   ||......:..::|.:.|....| 
Zfish   192 CRFKTIVHG--------DAKLANFCFSKDGLQVASVDF---QYVGGGCGMKDVIYFLGSCMDER- 244

  Fly   299 IYDEC-------LEHYYKNLQHHLDR 317
               ||       |::|:..|:..|::
Zfish   245 ---ECEKKAPGLLDYYFSELRKSLEK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 64/320 (20%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 46/234 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.