DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CHKov1

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster


Alignment Length:391 Identity:89/391 - (22%)
Similarity:171/391 - (43%) Gaps:96/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LINSQVDAGSK------DLMGYMGEYY-----KLHLEAEVK-GDKKKYFLNYFIKSLPRKNEPQR 79
            ::.|.||..||      ::....|:.|     ::::|.|:: |..|:  |:|.:| |||:.|..:
  Fly    18 VLKSNVDGYSKVRNFKAEMGSAAGDNYATNMLRVNIEVELQDGTTKE--LSYMVK-LPRQREINK 79

  Fly    80 EECERKGVFQKESALYSQILPKIQKYATKKLY----------PKCYYSRN---DILVLEDL-TQD 130
            |..:...:|:.|..:|:.::|:::     .||          .|.|..:|   :.:.|||| .:.
  Fly    80 EMMKHNNIFEIERTMYNLVVPEME-----ALYKAAGVEVTFGAKSYELKNAQTEYISLEDLCIKG 139

  Fly   131 YRHLRANEYYTLD--HYKIVLEHLSELHAASI---------------AWEEKENVKIYESYKNVL 178
            :::  ||....||  |.:.||..|::.|||:.               .:.::||..:.....|.:
  Fly   140 FKN--ANRLEGLDQAHTERVLRKLAQWHAATAVRVATKGQYPEIVLNGFFKEENRPMMNDMMNGM 202

  Fly   179 IELHLD-----SNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIR 238
            .::.:.     ..|..||..:||:               ::.:.|:|:.:.     :|.|::.  
  Fly   203 GQVFVKCCSTYEGNEAYIEKVKAL---------------KDVMIDELFKMC-----VVDPTEF-- 245

  Fly   239 NVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDEC 303
            |||.|.|:|.:||::.:::...:  ....:||||:::|.:...|:.:.|......|.:.:.:|..
  Fly   246 NVLNHGDSWSNNIMFQYDESGKI--KEVYMVDFQVSKYGTVAQDLYYFLISSTKLEDKLSKFDYY 308

  Fly   304 LEHYYKNLQHHLDRLGLDKNLITENNFRKECQR---------TRLAALVIWALTEPQTKMSPSIS 359
            ::.|:.||..||..|...|.|.:..:..|...:         |.:.|.|:...||     |.|..
  Fly   309 VKVYHDNLVEHLKILKYSKPLPSLRDIHKSLYKYGTFAYSVATGVMAAVLVDPTE-----SASFE 368

  Fly   360 N 360
            |
  Fly   369 N 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 72/319 (23%)
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 73/317 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.