DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG10560

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:329 Identity:75/329 - (22%)
Similarity:136/329 - (41%) Gaps:40/329 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERK 85
            ||...:...:.|.||.    .|.....:|.|:.|.| ||.:....:.:|: |...:..|:..:..
  Fly    38 KKTKALRAKAGVAAGE----NYATIMLRLELDVETK-DKSEVTKAFMLKT-PHDTDAYRKLLQET 96

  Fly    86 GVFQKESALYSQILPKI-QKYATKKLYPKCYYSRNDILVLED--LTQDYRHLRANEYYTLD---- 143
            .:|..|..:|..::|:: |.|....|..|......:|.|.|:  |.:|   ||...:..:|    
  Fly    97 NIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKVSENYVLLED---LRPRGFKNVDRLQG 158

  Fly   144 ----HYKIVLEHLSELHAASIA-------WEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAI 197
                |.:.||...::.||||..       :|||.....::|.:  ::....|.:....:..:...
  Fly   159 LDQAHTESVLRKFAQWHAASAVRVDLKGPYEEKYTNGFFKSKE--IMNFFCDRSAKILLNNIDQY 221

  Fly   198 VFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVL 262
                  :.|...:|....:.:||:::....:|   |.....|.|.|.|.|.:||::.:|.::.: 
  Fly   222 ------DGHAAYIKDLQSVSEKLFDIYNDIKE---PKSDEFNALNHGDGWSNNIMFQYNDKNEI- 276

  Fly   263 PNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITE 327
             :....||.||.::.|...|:.:.|....|.:::...:|..:..|:..|..||..|...|.|.|.
  Fly   277 -SNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELVKHLKLLNYSKKLPTL 340

  Fly   328 NNFR 331
            .:.|
  Fly   341 RSIR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 65/295 (22%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 67/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.