DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG10550

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:321 Identity:70/321 - (21%)
Similarity:142/321 - (44%) Gaps:58/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQK 90
            ::::..:..||:..:.|:   .|..|||:...|                      ..:..|:|.|
  Fly    64 VIVDILLKDGSEQRVSYI---LKTMLEADSGAD----------------------VIDGMGLFPK 103

  Fly    91 ESALYSQILPKIQKYATK-----KLYPKCYY--SRNDI--LVLEDLT-QDYRHLRANEYYTLDHY 145
            |..:|...:|:..|...:     :|.|||.:  :.:::  :|.|||: |::::....:.:.|.|.
  Fly   104 ERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHM 168

  Fly   146 KIVLEHLSELHAASIA-------WEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAAR 203
            :.||..|:||||||:.       ::...|:.||......|.|.........::..::        
  Fly   169 REVLRKLAELHAASVVAKEINGPYDAMYNMSIYNEQSRDLFESLGKQREEQFLKAMR-------- 225

  Fly   204 NPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIR---NVLCHRDTWDHNIVYYFNKESSVLPNA 265
              ::....|:::|. ::::.|...||.|..::...   |||.|.|.|.:||::.:.....:  :.
  Fly   226 --NWDLENAESYIA-RMWDPLEVFEEAVQVNQVDEDEFNVLNHGDCWSNNIMFNYKDNGEI--DR 285

  Fly   266 CCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLIT 326
            ..:||.|:.::.||..|:.:|:...||.:::...:|..::.|::.|...|..|...|.:.|
  Fly   286 TILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLKLLNYSKPIPT 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 65/297 (22%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 68/313 (22%)
APH 108..338 CDD:279908 55/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.