DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31370

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:368 Identity:92/368 - (25%)
Similarity:162/368 - (44%) Gaps:39/368 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYA---- 106
            |..:.:.|.|:...:|   .:|.|||..|.  ..|......:|:.|..:|.::||:..:..    
  Fly    51 YASVIIRARVEYITQK---GFFSKSLIIKT--VLEMFAGSALFKTEIGMYRKVLPEFARILRENN 110

  Fly   107 -TKKLYPKC-YYS--RNDILVLEDLTQ-DYRHLRANEYYTLDHYKI--VLEHLSELHAAS--IAW 162
             |.:||.:| |||  .:.:::.|||.: ||..:|..   .|.|.:|  ....|::.||.|  |..
  Fly   111 DTSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDR---VLTHGEICGAYSKLAKFHALSMKIIN 172

  Fly   163 EEKENVKIYESYKN--VLIEL-HLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLL 224
            |..|.||   .:|:  .|::: ::.|....:...|..|..|.....||:.::. :|| |:|.:::
  Fly   173 ERPEFVK---EFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEV-HFI-DRLRDIM 232

  Fly   225 TKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYI 289
            .:.:....|.   ..||||.|....||:...||||....: |.::|:|.........|:::.:|:
  Fly   233 KEYQTNPQPG---YYVLCHGDYHTRNIMVKHNKESGGFED-CMLLDYQGCYVAPLAFDLMYSIYM 293

  Fly   290 VASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTRLAALVIWALTEPQTKM 354
            :.:.|.|....:..|.:|:..|:..|.::|....|.....|.||..|.:....:..:...|.: :
  Fly   294 LMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMS-V 357

  Fly   355 SPSISNRLRSEEPEKF-DYYLNCDRSELLLRVIEIQPGYEETI 396
            ..|:......|..:|. |:...|  ..:|.|.  .:.||.|.:
  Fly   358 GLSLETATNEETDDKLQDFIEEC--KSILARF--ERSGYFENL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 75/288 (26%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 75/289 (26%)
APH <202..320 CDD:279908 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.