DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG13659

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:385 Identity:91/385 - (23%)
Similarity:170/385 - (44%) Gaps:52/385 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKDNVILIN-SQVDAGSKDLMGYMGEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREE 81
            |..|:.:|| |...|.:|      |::|   ......|.......:..:..||::..:...:::.
  Fly    31 KDSNLKVINLSFTPASAK------GDHYASIMFRARVEYTAQNGNFTKSLIIKTMIVEEGIKKDM 89

  Fly    82 CERKGVFQKESALYSQILPKIQKYATK-----KLYPKCYY---SRNDILVLEDLTQ-DYRHLRAN 137
            .:...:|..|..:|:::||:.::...:     |||.:|.|   ..:.||:.:||.: .|..:| :
  Fly    90 FKDSPLFTTEIGMYTKVLPEWERILRRANDPAKLYVECIYHSLQPHQILIFDDLVEMGYAVVR-D 153

  Fly   138 EYYTLDHYKIVLEHLSELHAASIAW--EEKENVKIYESYKNVLIELH--LDSNNSWYITG----- 193
            .:.|.:........|:::||.|:.:  |:.|.:|   .:||.|.|:.  :||:   .|:|     
  Fly   154 RFLTREEISSAYSKLAKIHAISMKFIHEQPEYLK---EFKNGLCEMPGLIDSS---IISGGMDPF 212

  Fly   194 ---LKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYF 255
               |..|..|:...|||:  |.....:|:|...:.:......|.   .|||||.|....|:::..
  Fly   213 MEMLGRIPELSKYQPHFK--KISLHFKDRLRETMQEYRNNPQPG---YNVLCHADFHSRNMMFKN 272

  Fly   256 NKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGL 320
            |||:....: |.::|:|........:|:::.:|::.....||...|..|.:|...|...|.::|.
  Fly   273 NKETGCFED-CMLLDYQGCNVAPMAVDLMYSIYMLMGPAQRREELDILLNYYLSILLETLKKIGY 336

  Fly   321 DKNLITENNFRKECQRTRLAALVIWALTEPQT------KMSPSISNRLRSEEPEKFDYYL 374
            ..::.||..|..|.:|.|....::.:...|.:      |:  .|.:.:.:||..|..|.|
  Fly   337 QGSMPTEQGFWAEMKRHRYYEFLLLSTFLPVSIGLRTHKL--DIGDMMHNEETRKKLYQL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 69/301 (23%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 70/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.