DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31097

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:343 Identity:85/343 - (24%)
Similarity:147/343 - (42%) Gaps:60/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIAQRTLSVVKKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVK-GDKKKYFLNYFIKSLPRK 74
            |||:......|.|....:.:....|:     :.....:::|:..:| |.:|:  .:|.:|::...
  Fly    24 LIAKDEPDFTKIDQFTTVAAVPPGGN-----FASVMLRVYLDIVMKDGSQKR--KSYVVKTMLES 81

  Fly    75 NEPQREECERKGVFQKESALYSQILPKIQK-YATK----KLYPKCY----YSRNDILVLEDL-TQ 129
            ::..:...|.: .|.||..:||..||:.:| |...    :|.|||.    ...|...:.||| |:
  Fly    82 DKGGKAVNEMR-YFHKEQQMYSTYLPQFEKIYRVAGHPVQLMPKCLEIGEIDGNIYFIFEDLSTR 145

  Fly   130 DYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITG- 193
            ::......:...::|.::.|..|:||||||:.::|:     |..|       |.|.:|.:.... 
  Fly   146 NFVAADRTKGVNMEHMRLSLRKLAELHAASVIYKER-----YGPY-------HADFDNGFARKDK 198

  Fly   194 ---------LKAIVFLAARNPHFQTMKA--------QNFIQDKLYNLLTKAEELVAPSKTIRNVL 241
                     :||..:.||       ||.        :||...:.|..|......|.|...  |||
  Fly   199 IEHSVRRFEVKAPEYKAA-------MKTWGIDECYLKNFPTTEQYGKLCLESLNVDPQDF--NVL 254

  Fly   242 CHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEH 306
            .|.|....||::.:|:..:  |:...|:|||:.::.|||.|:|.|:.:.|..:.....:|..:..
  Fly   255 THGDFSPSNILFKYNENGA--PSEALILDFQICKWASPTQDLLMLIILSARKDSSYKEFDNIVRI 317

  Fly   307 YYKNLQHHLDRLGLDKNL 324
            |::.|...|..|...|.|
  Fly   318 YWEYLIDFLRVLKYKKPL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 76/306 (25%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 78/315 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.