DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31098

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:321 Identity:74/321 - (23%)
Similarity:142/321 - (44%) Gaps:32/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKY 105
            |:..|.::.....: :|...|...:..:|..|:..  ......|..:|::|...|.::||:||..
  Fly    50 GFASEMHRASFNLQ-RGTAPKGKFSVIVKDHPKGQ--TGAVAHRSKLFKREILAYKEVLPRIQAL 111

  Fly   106 ATK-----KLYPKCYY---SRNDILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSELHAASIA 161
            ...     |:.|.|||   |....|:|||: ...:.:........||:....:|.:::|||.| |
  Fly   112 LQSIGDQTKIAPTCYYTTESPEPFLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACS-A 175

  Fly   162 WEEKENVKIYESYKNVLIELHLDSNN--SWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLL 224
            ...:::.::.|.:....|..:.|..:  :::...::.:   |....|:   |....|.:|::|| 
  Fly   176 LIAQDSPEVLEFFDEAPISRNPDRRDFLTFFPVNIRCV---AEEVAHW---KGYEEITEKMFNL- 233

  Fly   225 TKAEELVAPSKTI-------RNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLD 282
              ||.::..:.|:       ..|....|.|.:|::::.|.|:.. |:....:||||....|||:|
  Fly   234 --AENVLQRALTMFESTGKDFRVFNLTDLWINNLLFHINNETKE-PDDVVTLDFQLAYVGSPTID 295

  Fly   283 VLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTRLAALV 343
            :.:.||...:..||:..|...:..|.:.||..|::|....::.|......|..:|.|..::
  Fly   296 LNYFLYGSLNENVRKVHYKYIVREYQRVLQQTLEKLNYQGHIPTLKEIHIELIKTSLMGVI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 69/295 (23%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 70/296 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.