DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG11893

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster


Alignment Length:386 Identity:91/386 - (23%)
Similarity:167/386 - (43%) Gaps:63/386 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKY 105
            |::|   .....||....|.|:.....||::|.:...:::......:|..|...|::.||:.::.
  Fly    53 GDHYASVMFRTTAEYTTSKGKFCKPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERI 117

  Fly   106 ATK-----KLYPKCYY---SRNDILVLEDLT-QDYRHLRANEYYTLDHYKIVLEHLSELHAASIA 161
            ..:     ||:..|.|   ....:|:.|||. |.|..:| :....::.||.|...|::.||.|:.
  Fly   118 LREAGDDTKLFVPCIYHSLEPRQVLIFEDLVPQGYFVIR-DRPINMNEYKNVFSKLAKWHAVSMK 181

  Fly   162 WEEKENVKIYESYKNVLIELHLDSNNSWYITG-------LKAIVFLAARNPHFQTMKAQNFIQDK 219
             ...|...|.:.:|..|:|:....::....||       :..|..|....|||:.:| :|:|| :
  Fly   182 -VLNEQPDILKDFKYGLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIK-ENYIQ-R 243

  Fly   220 LYNLLTKAEELVAPSKTIRN----VLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPT 280
            :.:::.:..      |.:::    |:||.|....|::  |||...|:     .||||:...|..|
  Fly   244 MGDVMQEYR------KNVQSDGYYVMCHGDFHGRNMM--FNKNEEVM-----FVDFQICNLCPIT 295

  Fly   281 LDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTRLAALVIW 345
            :|:.:.:|::...|.|..:..:.:..|:..|:..|.::|....:.|.:...|:..|.:.....: 
  Fly   296 IDLSYSVYMLMEPEQRWDLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFL- 359

  Fly   346 ALTEPQTKMSPSI----SNRLRSEE----PE------KFDYYLNCDRSELLLRVIEIQPGY 392
                 .|..||.|    :|..:..|    ||      .:|.|:. |..:||.:..|:  ||
  Fly   360 -----LTTFSPMIVAVKANTFKIHELIQDPEIRQKSYLYDPYVQ-DVKKLLGKYEEM--GY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 71/297 (24%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 71/298 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.