DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31104

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:319 Identity:72/319 - (22%)
Similarity:141/319 - (44%) Gaps:36/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKY 105
            |::|   ....:.|....|.|:|....||::|.:...:::......:|:.|..:|...||:.::.
  Fly    51 GDHYASVMFRTKVEYTTPKGKFFKPLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERI 115

  Fly   106 ATK-----KLYPKCYY---SRNDILVLEDLT-QDYRHLRANEYYTLDHYKIVLEHLSELHAASIA 161
            ..:     ||:..|.|   ....:::.|||. |.|..:| :...:|...|:..:.|::.||.|:.
  Fly   116 LREAGDNTKLFVPCIYHSLKPRQVMIFEDLVPQGYTVIR-DSPPSLGDLKLAFDKLAKWHAVSMK 179

  Fly   162 WEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNP-------HFQTMKAQNFIQDK 219
             ...|.....:.::..|.|:.....:.:..||:...:.:..:.|       ||:.:| .|::|  
  Fly   180 -VINEQPYFLKEFQYGLFEMPTIDTDPFITTGMTNFIEMLDKMPELRKYKHHFEKIK-DNYMQ-- 240

  Fly   220 LYNLLTKAE-ELVAPSKTIRN----VLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSP 279
                  :.| |:....|..||    ||||.|....|:::..|||.....:. .:|||||:..|..
  Fly   241 ------RLEVEMHEYHKYRRNDRYYVLCHGDFHLRNMMFRHNKELGAYDDV-MLVDFQLSNLCPI 298

  Fly   280 TLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTR 338
            |:|:.:.:|::...|.|..:.:..:..|:..|...|.::|...::.|:....::.|..:
  Fly   299 TVDLTYSVYMLMEPEQRWEMGENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 69/298 (23%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 69/299 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.