DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG11892

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651372.1 Gene:CG11892 / 43053 FlyBaseID:FBgn0039313 Length:439 Species:Drosophila melanogaster


Alignment Length:412 Identity:92/412 - (22%)
Similarity:176/412 - (42%) Gaps:56/412 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QRTLSVVKKDNVILIN-SQVDAGSKDLMGYMGEYY---KLHLEAE-VKGDKKKYFLNYFIKSLPR 73
            |..|....||.:|.|| .:|:..    :| .||.|   ...::|: .:.|......:|.:||...
  Fly    43 QDALRKYYKDQLIRINWVKVNPA----LG-KGENYGGVLTRVKAQFTRSDGSSQLGHYIVKSTFE 102

  Fly    74 KNEPQREECERKGVFQKESALYSQILPKIQKYATKKL--------YPKCYYSRNDILVLEDLTQD 130
            .||..:...:...:|.:|..:|.|:||| ||...:::        ........|..|:.||    
  Fly   103 GNEFAQNAMKPYDIFNREMIIYEQVLPK-QKALLREIGDAEQIFAETMAVDIDNSALIFED---- 162

  Fly   131 YRHLRANEYYTLDHY--------KIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNN 187
               |.|..:...|..        :|||..|:::||.|....|:|| .|.|||.......:.|:..
  Fly   163 ---LNARGFVMPDRLVGLDQKLARIVLRKLAKMHATSAVLNEREN-HILESYDRGFFNRYTDNYE 223

  Fly   188 SWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEEL------VAPSKTIRNVLCHRDT 246
            ..::..|:|.....|:.|.::.      ..:||..|:....||      ::|...  |||.|.|.
  Fly   224 PAFVGMLQAATRRVAQWPGYEK------YAEKLKALVPIYMELGKRIFDISPGHI--NVLAHGDL 280

  Fly   247 WDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNL 311
            |.:|::..::|::.. |....|:|||.|.:.||.||:.:.:......::.:...::.:.:|:::.
  Fly   281 WTNNVLVKYDKQTGE-PIDVVIIDFQYTAWGSPALDLFYFMNSSLEFDLHQNHQEQLIAYYFRHF 344

  Fly   312 QHHLDRLGLDKNLITENNFRKECQRTRLAA----LVIWALTEPQTKMSPSISNRLRSEEPEKFDY 372
            ...|.:|.....:.:.:.|.::.|:.:..|    :.::.: :...:.:.:..|.|........::
  Fly   345 ADTLKKLQYRSTIPSLHQFHQQLQQKKFYAAHTSISVFPV-QRNVETADADFNALMENNQRAMNF 408

  Fly   373 YLNCDRSELLLRVI-EIQPGYE 393
            ...|.|:.:..|:: |:.|.:|
  Fly   409 KDACYRNPIAQRILRELLPDFE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 72/303 (24%)
CG11892NP_651372.1 EcKinase 68..353 CDD:281023 72/302 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.