DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG6908

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:307 Identity:83/307 - (27%)
Similarity:137/307 - (44%) Gaps:47/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQ 103
            ||.|     :.:.|.|: .|..:..::|..|.||  |...||......||.||...|.|.:|:.:
  Fly    82 GENYTTLLLRANFELEL-NDGSEQSISYMAKILP--NSGNRENVASWKVFYKERNTYGQYIPEFE 143

  Fly   104 ---KYATKKLY--PKCYYSR----NDILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSELHAA 158
               |.|.||:.  |:.|.|:    ::::||||| .:.:|::.......:.|.:..||.|::.|||
  Fly   144 QMYKDAGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAA 208

  Fly   159 S-IAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIV--FLAARNPHFQTMKAQNFIQ--- 217
            | :.:|.|.:..  |.|...|..: :||........|||.:  |     |.:......|.:|   
  Fly   209 SAVRFELKGSYP--EEYNQNLCSV-VDSLKELRENQLKAYIDAF-----PLYDASHLTNDVQAYG 265

  Fly   218 ----DKLYNLLTKAE-ELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYC 277
                |...:...|.| |.        .||.|.|.|.:||:|.:::...:.  ....||.|::::.
  Fly   266 SQADDMFQSFAPKIEGEF--------RVLNHGDAWCNNIMYQYDEAGKLA--EVNFVDLQMSRFS 320

  Fly   278 SPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNL 324
            ||..|:|:|:......:::.|.:|..::.|::.|...|..|...|.|
  Fly   321 SPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 80/300 (27%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 81/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.