DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG6834

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:409 Identity:101/409 - (24%)
Similarity:173/409 - (42%) Gaps:59/409 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LINSQVDAGSKDLMGYM-------GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREE 81
            |:.:.||..|| ::|:.       ||.|   .|.:..:|:...|...|..|:..:|. |.||.|:
  Fly    73 LLAAHVDQFSK-IVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLKVPH-NVPQMEQ 135

  Fly    82 -CERKGVFQKESALYSQILPKIQK-YATKKL----YPKCYYSRN-------DILVLEDLTQD-YR 132
             ......|..|:.:||.||||::: |..|.|    .||.:...:       :.:::.||:|| ::
  Fly   136 MLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEPKLANTVLMSDLSQDGFK 200

  Fly   133 HLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAI 197
            :|...|...|:..|..|:.|::.||||     ..||::...|::..:...:..|....:...:.:
  Fly   201 NLNRLECLNLEQTKFALKKLAQFHAAS-----SMNVQVNGPYEDQFVNGVMGGNKEVLMAFYEGM 260

  Fly   198 V--FLAARNPHFQTMKAQNFIQDKL----YNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFN 256
            |  |..|...:.:..|.....::||    ..:....|.|:.......|||.|.|.|.:|:::..:
  Fly   261 VASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTADPDEFNVLNHGDCWMNNLLFKLD 325

  Fly   257 KESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLD 321
            .:..|  .....||||..:|.|||.|:.:|:......:.:...::..:.||::.|..|||.||..
  Fly   326 SKGEV--QDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHEQLTQHLDLLGFT 388

  Fly   322 KNLITENNFRKECQRTRLAALVI----WALTEPQTKMSPSISNRLRSEEPEKFDYYLNCDRSEL- 381
                     .|:.....|..|:.    ||:. |...:.|.:  .|...|...|:.:|....|.. 
  Fly   389 ---------GKQPSLRELHMLMYKHGSWAVF-PSIGVLPIV--LLDPNESATFENFLGDSESSAK 441

  Fly   382 ---LLRVIEIQPGYEETIM 397
               ||...:...||.|.::
  Fly   442 FKNLLYTNKRYHGYIEKLL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 77/307 (25%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 77/299 (26%)
EcKinase 529..813 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.