DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG6830

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:477 Identity:104/477 - (21%)
Similarity:188/477 - (39%) Gaps:135/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LINSQVDAGSKDLMGYM-------GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREE 81
            |:.:.||..|| ::|:.       ||.|   .|.:..:|:...|...|..|:..:|. :.||.|:
  Fly    58 LLAADVDQFSK-IVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMKVPH-DTPQMEQ 120

  Fly    82 -CERKGVFQKESALYSQILPKIQK-YATK----KLYPKCY--------YSRNDILVLEDLTQD-Y 131
             ......|..|:|.|::||||::: |..|    |..|:.:        ...|.:| :.||.|: :
  Fly   121 MMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANTVL-MHDLGQNGF 184

  Fly   132 RHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKA 196
            :::...|...|:..|..|..|::.|||....     |:::..|.::.:...:.:|..      ..
  Fly   185 KNINRLECLNLEQTKFALTRLAQFHAAGATM-----VQVHGPYPDIFVNGVMGNNKE------AI 238

  Fly   197 IVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEEL----------------VAPSKTIRNVLCHRD 245
            |.|:......|:|....|.  ||..|.....|:|                |.|::.  |.|.|.|
  Fly   239 IAFMEGMLASFRTSFMANL--DKFKNGEEYREKLEKALAGLTMEFMKLGIVDPNEF--NALNHGD 299

  Fly   246 TWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEV--RRAIYDECLEHYY 308
            .|.:|:::..|....:  .....||||..:|.||.:|:|:  :|::|.::  :.:.:|..:.||.
  Fly   300 CWMNNLLFKMNSSGDL--EDMVFVDFQNPKYGSPAMDLLY--FIISSVQIDYKLSHFDFFIRHYQ 360

  Fly   309 KNLQHHLDRLG----------LDKNLI-------------------------TENNF-------- 330
            :.|..||..||          |.:.||                         |.:||        
  Fly   361 EALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSDSADGV 425

  Fly   331 --------RKECQRTRLAALVIW--------ALTEPQTKMSPSISNRLRSEEP-----EKFDYYL 374
                    .|.||. .:..::.|        ..|:|   :.|.:...|:.::|     ::...:|
  Fly   426 SFRGSLYANKRCQE-YIERILPWLDNRGFLEVSTDP---LPPELLAALKPQQPQPENTDQIPDWL 486

  Fly   375 NCDRSELLLRVIEIQPGYEETI 396
            |.|..:.:  ::..:|.:|:.:
  Fly   487 NIDDFKEI--ILSAEPNFEKIL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 77/320 (24%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 77/312 (25%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.