DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and JhI-26

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:367 Identity:82/367 - (22%)
Similarity:153/367 - (41%) Gaps:41/367 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DLMGYMGEY-----YKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQ 97
            |::|:...:     |:..:..|..|  :|:.....:|..|.......|..:...:|..|...|::
  Fly    45 DVIGHSEAFMLTFCYRTTINFEYDG--QKFQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTE 107

  Fly    98 ILPKIQKYATKKL-YPKCYY----SRNDILVLEDLT-QDYRHLRANEYYTLDHYKIVLEHLSELH 156
            |||:.||:...|. .||.||    ..:.:.:||:.. |.:|..:.....:|.|..|.:.:|...|
  Fly   108 ILPEFQKFTDGKFAAPKYYYGELNQHSAVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFH 172

  Fly   157 AASIAWEEKENVKIYESYKNVLIELHLDSN--NSWYITGLKAIVFLAARNPHFQTMKAQNFIQDK 219
            ..:.|.:.|...|..:...|:....:.:.|  ..|.:|...:|...|.....:|....:.|::..
  Fly   173 GFAYAMKHKNPEKFAQLTDNLKESRYANDNIHPEWKLTMKTSIDRAAKAVATYQPQIDEEFVKKF 237

  Fly   220 LYNLLTKAE---ELVAPSKTIRNVLCHRDTWDHNIVY-YFNKESSVLPNACCIVDFQLTQYCSPT 280
            .:.:...::   :.|||.:.:. .|||.|...:|:.| |.:||.   |....:.|:|..:..||.
  Fly   238 CFMISDYSQYGRQRVAPREPLA-TLCHGDYVRNNVAYRYDDKEE---PQEIMMFDYQTLRVSSPM 298

  Fly   281 LDVLFLLYIVASAEVR----RAIYDE---CLEHYYKNLQHHLDRLGLDKNLITENNFRKECQR-- 336
            :|:...|.:...||||    .||:.|   .|.:.|:  :|..:.:   .:.::.....||..|  
  Fly   299 VDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSYR--EHAKEEV---PDFLSRGELLKEYVRFL 358

  Fly   337 ---TRLAALVIWALTEPQTKMSPSISNRLRSEEPEKFDYYLN 375
               ..::|..:.:|.:| ..:||.....|:..:.|..:..:|
  Fly   359 PYSLSISASFLMSLVDP-LDISPEEMFALQLSDEEIIERTMN 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 70/301 (23%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 66/281 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.