DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG9259

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:433 Identity:127/433 - (29%)
Similarity:189/433 - (43%) Gaps:44/433 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSSEECHLIAQRTL--SVVKKDNVI-LINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLN 65
            ||..|...:.||..  .|...|... ::|..:...|....||:|.:..||:..::...::...|.
  Fly     7 LSPTEIRGLCQRYFHQDVSNSDTGFDIVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSEEVRQLT 71

  Fly    66 YFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKKLYPKCYYSRNDILVLEDLT-Q 129
            :|.||.|..||.:.|..|..|||:||.|:|..:||.:.| |..::.|||||:..::|:.|:|. |
  Fly    72 FFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHK-ACAEVAPKCYYADKNLLIFENLADQ 135

  Fly   130 DYRHLRANE-YYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITG 193
            .||.....: ..|.:.....|:.|:.:||.||..|::...||.:|....::|....|:.|     
  Fly   136 GYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSDVS----- 195

  Fly   194 LKAIVFLAARNPHFQTMKAQN-------FI------QDKL-YNLLTKAE------ELVAPSKTIR 238
                      ..|.:.:..||       ||      |.|| |.|....|      |.|..|...:
  Fly   196 ----------PEHMRMVNFQNACLVLKEFIKLIPKYQSKLDYVLENFTEKMSFIFEAVKTSDVYQ 250

  Fly   239 NVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDEC 303
            |.:.|.|.|.:||::.:.:...| |..|.:|||||.:|..|.||||.:|.|..|.|.|.|...|.
  Fly   251 NTILHGDLWANNIMFQYGRYGEV-PLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSEL 314

  Fly   304 LEHYYKNLQHHLDRLGLD-KNLITENNFRKECQRTRLAALVIWALTEPQTKMSPSISNRLRSEEP 367
            |..||:.:...|.|..|| ...|.|..|.:..|:.|...|:...|......:.|..:.:|.|...
  Fly   315 LAEYYRFMTEFLKRADLDIARFIPEQTFYESVQKFRSVGLIESCLFCHLVILPPHCTQKLTSSVD 379

  Fly   368 EKFDYYLNCDRSELLLRVIEIQPGYEETIMTPIRELVDYLMEN 410
            ...|::.| .|.|:.|........|...::..|.:.||..:.|
  Fly   380 GFNDFFTN-KRIEICLEAFNTDELYRSRLVDMIEDFVDQFVIN 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 96/299 (32%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 90/287 (31%)
APH <252..325 CDD:279908 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473178
Domainoid 1 1.000 45 1.000 Domainoid score I8247
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333735at33208
OrthoFinder 1 1.000 - - FOG0005926
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.