DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and F59B1.10

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:414 Identity:94/414 - (22%)
Similarity:169/414 - (40%) Gaps:102/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEECHLIAQRTLSVVKKDN-----VILINSQVDAGS----KDLMGYMGEYYKLHLEAEV-KGDKK 60
            |.|..|.|:..:.|:...|     |:||:......|    |.|:..:..:  :|::|.: ||.::
 Worm    34 STESELTAESKMEVIGDGNGFSSRVLLISCNWTIPSAHLPKKLILKIVSF--VHIQALIDKGKQQ 96

  Fly    61 KYFL----------NYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYA------TKK 109
            ...|          .||..|..:.:..:....|..|.|..::.|    :||:..|.      :.|
 Worm    97 NASLITKEVEEQMYAYFESSCKKMHNQEMNFYEVAGKFNSKTLL----IPKVYFYTKLDEKNSNK 157

  Fly   110 LYPKCYYSRNDILVLEDLTQDYRHLRANEYYTLDHYKIVLEHLSELHAASI---AWEEKENVKI- 170
            .:....|....|:         ||  :.:..|::..:.:|..:::|.|.|:   |...|:..|| 
 Worm   158 GFIGMEYVEGSIV---------RH--SYDTCTIEEIQPILRAIAKLQALSLQNPAEISKDLQKID 211

  Fly   171 -----YESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNF------IQDKLYNLL 224
                 .|:.|.:|.|           :|:|.| |...||     ::...|      |::|...:|
 Worm   212 NGAIFQETLKMMLSE-----------SGIKGI-FEQCRN-----LERSRFGEKVDRIEEKRNEIL 259

  Fly   225 --TKAEELVAPSKTI---RNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVL 284
              .||..|   :|.:   :|||||.|.|..|.::   .|::.:..|..|||:|::...:|..|::
 Worm   260 DFEKAFNL---NKVVGIKQNVLCHGDLWAANFLW---TENNGVFCATRIVDYQMSHLGNPAEDLV 318

  Fly   285 FLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLIT----ENNFRKECQRTRLAALVIW 345
            .||....:...|:|.:.:.||.:|   .:.|:.||..:...|    :.:|:.......||.|.::
 Worm   319 RLLVSTITGADRQAHWQQILEQFY---SYFLNELGSGEAPYTLEQLKLSFKLYFPVGALALLPLF 380

  Fly   346 ALTEPQTKMSPSISNRLRSEEPEK 369
                     .|::..:|...:.||
 Worm   381 ---------GPAVDAKLEGMDSEK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 71/314 (23%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 94/414 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.