DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG9497

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster


Alignment Length:363 Identity:89/363 - (24%)
Similarity:158/363 - (43%) Gaps:58/363 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLLSSEECHLIAQRTLSVVKKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLN 65
            :|:...||....|.||.      .|.|::..:..||.....|..:.|::.:..: :.|..:..:.
  Fly    17 LDVPFFEEVLETALRTA------RVQLLSIHIRMGSSTGENYCSQIYRVKVSFK-RPDHPEQHMA 74

  Fly    66 YFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQ--KYATKKLYPKCYY---SRNDILVLE 125
            :.:||:|..:..  |..:...|:.||...|.::||:::  ....::..||.|:   ...:.||.|
  Fly    75 FIVKSIPHLDSV--EFIDDLQVYLKEKITYYEVLPRLELLMQCNRRFGPKLYHYLKQPENSLVFE 137

  Fly   126 DLTQD-----YRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIE----- 180
            ||.:.     .|.|..||    :|.::|:|.|:|.||.|:|....: ..|:::|.:.::.     
  Fly   138 DLAEKGFVMASRELGLNE----EHCQLVMERLAEFHATSMALAVVD-PHIFDAYGDGMLSPRGLA 197

  Fly   181 ------LHLDSNNSWYITGLKAIVFLAARNPHFQTM--KAQNFIQDKLYNLLTKAEELVAPSKTI 237
                  :...|.|.      |.:..|.:..|.|:.:  |...::|::..||    |...||.:..
  Fly   198 KDDGLLMQFFSGNG------KELHHLVSTWPGFEKIAEKIGKYMQNQRANL----ERSQAPQEKE 252

  Fly   238 RNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDE 302
            ..||.|.|.|.:|::  |..:.:..|....::||||:.:.||.:|:.:..|...:.||.|....:
  Fly   253 VKVLNHGDLWVNNML--FKYDGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTLEVLRHRRTQ 315

  Fly   303 CLEHYYKNLQHHLDRLGLDKNL-------ITENNFRKE 333
            .|..|:..|...|  |.||..:       |.|...|:|
  Fly   316 LLRTYHARLAKTL--LDLDMGIPVPSYEQILEEVHRRE 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 72/300 (24%)
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 73/303 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.