DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG5126

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:354 Identity:77/354 - (21%)
Similarity:137/354 - (38%) Gaps:87/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SKDLMGYMGEYYKLHLEAEVKGDKK-KYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQIL 99
            |..|.|:|...|.:.|:..:...|: :..|..|:|.    .|..||.......|..|...|::||
  Fly    37 SNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMKG----TEEFRESSNSYIQFSNEIFAYAEIL 97

  Fly   100 P---------KIQKYATKKLYPKCYYS-----------RNDILVLEDLTQDYRHLRANEY----- 139
            |         .::....|...|.||::           |..:|.|       :||:.:.|     
  Fly    98 PAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLAL-------KHLKGDGYQLGPR 155

  Fly   140 YTL--DHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELH--------LDSNNSWYITGL 194
            .||  |..:.::..:...||...|      .||.:  .||...|.        :.|:.......|
  Fly   156 LTLRRDQLEAMVGLVGPFHALGYA------TKILQ--PNVHARLRAGVVDMPFVSSSGKGIFDVL 212

  Fly   195 KAIVF--------------LAARNPHF----QTMKAQNFIQDKLYNLLTK------AEELVAPSK 235
            ..:.|              |...:|.|    :.::.:.|.|..|  ||.:      ||:  .|..
  Fly   213 YRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTL--LLERIRTSSFAED--QPDS 273

  Fly   236 TIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIY 300
            .....| |.|...:|:::::..|..|  :|...:|||..::.:..:|:.|.:|:...:|.|:.||
  Fly   274 HFATFL-HGDYNRNNVLFHYGAEDKV--DAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIY 335

  Fly   301 DECLEHYYKNLQHHLDR-LGLDKNLITEN 328
            .:.|..|::::...|:. |..::|.:|::
  Fly   336 ADLLRKYHRSMIEMLELVLRRNRNELTDD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 72/338 (21%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 72/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.