DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31974

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:380 Identity:86/380 - (22%)
Similarity:146/380 - (38%) Gaps:93/380 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EECHLIAQRTLSVVKK-DNV--ILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFI 68
            |.|.|.:..|..:.|. ||.  |:::.|....|.|     |....|.|.|::.......:...| 
  Fly    20 EGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSAD-----GGIRDLPLIAKLPPLTNDLYWQIF- 78

  Fly    69 KSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKK---------LYPKCYYS------- 117
                   :|:| .|      ..|:|:|..:.|::.|...:.         .:|:.|.|       
  Fly    79 -------QPER-TC------ITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNR 129

  Fly   118 -----RNDILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESY-- 174
                 |:.:||.|:: |:.||....:..|.|....::|.:|::.||..||...|: .::||.|  
  Fly   130 ATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKK-PQVYEEYVR 193

  Fly   175 ---------------------KNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQD 218
                                 |.:|.::.|.:::...:..:|.::.:      ||..:|.|.:.|
  Fly   194 PYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDI------FQAFQASNDVDD 252

  Fly   219 KLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVY-YFNKESSVLPNACCIVDFQLTQYCSPTLD 282
                         .|..|    |.|.|.|.:|::. |..:.....|....|||||:.||.|...|
  Fly   253 -------------GPFTT----LVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHD 300

  Fly   283 VLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRT 337
            ::|:|:......|....:...|..||......|..:.:|.:..|...|.:|.|:|
  Fly   301 IIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQT 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 69/323 (21%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 75/345 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.