DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31300

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:382 Identity:82/382 - (21%)
Similarity:166/382 - (43%) Gaps:50/382 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKY 105
            |::|   .....||....|.|:.....||::|.::..:::......:|:.|..:|.|:||:.::.
  Fly    53 GDHYASVMFRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERI 117

  Fly   106 ATK-----KLYPKCYY---SRNDILVLEDLTQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAW 162
            ..:     ||:..|.|   ....:::.|||.....::..:.....:..|.....|::.||.|:.:
  Fly   118 LRESGDDTKLFVPCIYHSLEPRKVMIFEDLVPQGYYVIRDRPVAQEELKTAFAKLAKWHAISMKY 182

  Fly   163 EEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAAR-------NPHFQTMKAQNFIQD-- 218
             .||.....:.:|..|.|:.....:.:..||:::.:.:..|       .|||:.:| ..::|.  
  Fly   183 -IKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIK-DKYMQRLQ 245

  Fly   219 ---KLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPT 280
               |.|:...|::...        ||||.|....|:::..||.:....:. .:||||::..|..|
  Fly   246 AVMKEYHENRKSDAFY--------VLCHGDFHLRNMMFKNNKGTGAHEDT-MLVDFQISNLCPIT 301

  Fly   281 LDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTR-----LA 340
            :|:.:.:|::...|.||.:..:.:.||...|...|..:|....|.|:.....|..:.:     |.
  Fly   302 IDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLL 366

  Fly   341 ALVIWALTEPQTKMSPSISNRLRSEEPEKFDYYLNC---DRSELLLRVIEIQPGYEE 394
            :..:..:...::| |..:::.::..|..:..|:|:.   |.|:||       |.:|:
  Fly   367 STFLPLILAIKSK-SFKVNDLIQDPETRQKTYFLDTYVKDVSKLL-------PKFEQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 66/297 (22%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 66/298 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.