DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31099

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:408 Identity:94/408 - (23%)
Similarity:173/408 - (42%) Gaps:72/408 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HLIAQRTLSVVKKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRK 74
            |||..|..:|       |:..||....:|.                  ..||.|   |:......
  Fly    37 HLIQFRNCTV-------LLPIQVKVQLRDF------------------TMKKLF---FLLKAQHG 73

  Fly    75 NEPQREECERKGVFQKESALYSQILPKIQ---KYATKKLY--PKCY---YSRN-DILVLEDL-TQ 129
            .:.|.....:..:||:|..:|..:|||::   :...||:.  |:.:   ||.. ..::|||| .:
  Fly    74 TDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLLEDLKAK 138

  Fly   130 DYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIE-LHLDSNNSWYITG 193
            .|:::.....:.....|.||:.|::.||||....||     :.::.|:|:. ::..:|.|     
  Fly   139 SYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEK-----HGAFSNLLVNGVYTKANES----- 193

  Fly   194 LKAIVFLAARNPHFQTMKAQNF-IQDKLY-NLLTKAEELV-------APSKTIRNVLCHRDTWDH 249
                |.....:|.....:.:.: :.|..: .|:.|.::||       :|.....|||.|.|.|.:
  Fly   194 ----VLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVN 254

  Fly   250 NIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHH 314
            |:::.|:....|...|  ::|:||.:|.||.:|:.:.:...|..:::.|.:|..:::|:.:|..:
  Fly   255 NVMFKFDDSGHVEDTA--LLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDN 317

  Fly   315 LDRLGLDKNLITENNFRKECQRTRLAALVIWALTEPQTKMSPSISNRLRSEEPEKFDYYLNC--- 376
            |..|....:|....:.|....:..|||.|:.....|.|.|     |:...|..|::...:.|   
  Fly   318 LKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMM-----NQFEDEVNERYASKMKCAMF 377

  Fly   377 DRSELLLRVIEIQPGYEE 394
            ...:.:..:.:|.|..||
  Fly   378 TSRKYIQAIKDILPWMEE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 67/297 (23%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 73/322 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.