DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG1561

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:351 Identity:85/351 - (24%)
Similarity:142/351 - (40%) Gaps:86/351 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LINSQVDAGSKDLMGY----MGEYYKLHLE-AEVKGDKKKYFLNY----------------FIKS 70
            |.|.||....:.|:..    :|...:|.|| |..|||      ||                .:..
  Fly   223 LPNEQVTQFLRQLVSQLWPELGANPELRLERASAKGD------NYLGVVWRLQAASDSKRSLVVK 281

  Fly    71 LPRKNEPQREECERKGVFQKESALYSQILPKIQKYATK---------KLYPKCYYSR----NDIL 122
            ||.:|..:|::...:..|.:|:|.|...||.......|         :.:..|:.:|    |:.:
  Fly   282 LPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGDDRFRQHALCFGTRQDEPNECI 346

  Fly   123 VLEDLTQDYRHLRANEYYTL--DHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDS 185
            |||||:.....|. |.:..|  :|.:.|:...::|||.|:|.:.:...|:.:..:  |::     
  Fly   347 VLEDLSCAGFSLH-NRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQ--LVD----- 403

  Fly   186 NNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAE-----------------ELVAP 233
                        :|...|:.|...:..:|..:..|..||..|:                 ||:.|
  Fly   404 ------------IFEQRRDDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLP 456

  Fly   234 SKTIRN-----VLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASA 293
            ..:..|     |:||.|.|::||:|...:...:  ....::|:||.:|.||..|:.:.|:...|.
  Fly   457 LVSGFNCEPFAVICHGDCWNNNILYKSTERGEL--EDVRLIDWQLMRYASPVTDLAYFLFTCTSR 519

  Fly   294 EVRRAIYDECLEHYYKNLQHHLDRLG 319
            ..|:...:..||.||:.|...|.|||
  Fly   520 RFRQRHLENMLEDYYEELGLQLIRLG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 78/335 (23%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 75/317 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.