DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31975

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:437 Identity:98/437 - (22%)
Similarity:172/437 - (39%) Gaps:126/437 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIAQRTLSVVKK-DN----VILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKS 70
            |:...|.|:.|. ||    ::.|::::...:       ||.::..|.|:|.....||: .:|   
  Fly    25 LLNYHTSSLTKPGDNYGSVLLAIHARLQKSN-------GESFEEQLVAKVPPIDPKYW-QFF--- 78

  Fly    71 LPRKNEPQREECERKGVFQKESALYSQILPKIQKYATK---------KLYPKCYYSR-------- 118
                 :|: :.|      ..|:|:|..:.|.:.....:         |.:|:.|..|        
  Fly    79 -----QPE-QTC------LTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSS 131

  Fly   119 ----NDILVLEDL-TQDY---RHLRANEYYTLDHYKIVLEHLSELHAASIA-------------- 161
                |.:||||:| :..|   :.|:|   :.|.|..:.|::::|.||.|:|              
  Fly   132 KVDQNAVLVLENLRSSGYVSGQRLKA---FDLAHTLLALKYMAEFHALSLALRILRPEVFREQVR 193

  Fly   162 -------WE----EKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNF 215
                   |.    |.::|...|:.:::....:.||.             |.||      ||.   
  Fly   194 PFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSR-------------LVAR------MKE--- 236

  Fly   216 IQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPT 280
            :.|:.:..|..|.:  .|.....::: |.|.|.:||::.:....:  |....|:|||..||.|..
  Fly   237 LSDQFFEFLAAAPD--RPDGPFTSII-HCDFWINNIMFRYGPTGT--PVELKIIDFQTAQYDSVV 296

  Fly   281 LDVL-FLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQR-------- 336
            .|:: |||..|.:| :....::..||.||:..:..|.|:|....:.|...||.|.:|        
  Fly   297 HDIISFLLSSVDTA-ILEVEFEHMLEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPH 360

  Fly   337 ----TRL----AALVIWALTEPQTKMSPSISNRLRSEEPEKFDYYLN 375
                ||.    :||:..:..|.:.|::..:.|........|....||
  Fly   361 AIFMTRFILADSALIGDSEAEERPKLTDVLKNTGSERISRKLSQILN 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 75/328 (23%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 78/352 (22%)
APH <214..329 CDD:279908 35/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.